PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G022100.1
Common NameB456_009G022100, LOC105770916
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 472aa    MW: 51014.6 Da    PI: 6.9471
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G022100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.36.2e-32250305156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Gorai.009G022100.1 250 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVEGLTNDEVKSHLQKYRLH 305
                         68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.407247307IPR017930Myb domain
SuperFamilySSF466891.15E-16248308IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.4E-28248308IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-26250305IPR006447Myb domain, plants
PfamPF002498.4E-7252303IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    Send to blast
MASPTGLTLD CKPHSYSMLL KSFGDQQIDQ TQKLEDFLGR LEEERLKIDA FKRELPLCMQ  60
LLTNAVETSR QQLHACRANQ GSRPVLEEFI PLKNSSSENS DKSQNISDKA NWMTSAQLWS  120
QAGNETKPPQ SSVASPKEAD IGFNVSPKLG LDTKQRNGGA FLPFSKDRQN PCPGSTLQPL  180
PDLALASMNE DMDDKKCSET ENGCQRRENS GRTGNGGALV EQGKGTSCNA AEGQTTNGNT  240
NTNTGQPHRK ARRCWSPDLH RRFVNALQML GGSQVATPKQ IRELMKVEGL TNDEVKSHLQ  300
KYRLHTRRSS PSPQAPGAPT PQLVVLGGIW VSPEYATAAA AAYGGTPTLY GAHHPAAPHA  360
PPPHFCASPV PQEFYSATAT PAPTPPPQLH HHTLQQQLHM YKSTSQAHSL PESDVRGAGD  420
HSESIEDGKS ESSSWKGESG ENGGGADQRK GLAALREDGE ESNGSEITLK F*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012447737.10.0PREDICTED: transcription activator GLK2-like
TrEMBLA0A0D2Q7J80.0A0A0D2Q7J8_G
STRINGPOPTR_0018s06410.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM71342843
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-117G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]